PDB entry 1m9s

View 1m9s on RCSB PDB site
Description: Crystal structure of Internalin B (InlB), a Listeria monocytogenes virulence protein containing SH3-like domains.
Class: signaling protein
Keywords: internalin, cell invasion, GW domains, SH3 domains, SIGNALING PROTEIN
Deposited on 2002-07-29, released 2002-11-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.273
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: internalin b
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: inlB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25147 (2-End)
      • variant (7)
      • variant (15)
      • variant (83)
      • variant (98)
      • variant (362)
    Domains in SCOPe 2.03: d1m9sa1, d1m9sa2, d1m9sa3, d1m9sa4, d1m9sa5
  • Heterogens: TB, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m9sA (A:)
    mgetitvstpikqifpddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqg
    iqylpnvtklflngnkltdikpltnlknlgwlfldenkikdlsslkdlkklkslslehng
    isdinglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqnl
    ylsknhisdlralaglknldvlelfsqeclnkpinhqsnlvvpntvkntdgslvtpeiis
    ddgdyekpnvkwhlpeftnevsfifyqpvtigkakarfhgrvtqplkevytvsydvdgtv
    iktkveagtritapkpptkqgyvfkgwytekngghewnfntdymsgndftlyavfkaett
    ektvnltryvkyirgnagiyklprednslkqgtlashrckaltvdrearnggklwyrlkn
    igwtkaenlsldrydkmeydkgvtayarvrnasgnsvwtkpyntagakhvnklsvyqgkn
    mrilreaktpittwyqfsiggkvigwvdtralntfykqsmekptrltryvsankagesyy
    kvpvadnpvkrgtlakyknqklivdcqatiegqlwyrirtsstfigwtkaanlraqkleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m9sA (A:)
    etitvstpikqifpddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqgiq
    ylpnvtklflngnkltdikpltnlknlgwlfldenkikdlsslkdlkklkslslehngis
    dinglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqnlyl
    sknhisdlralaglknldvlelfsqeclnkpinhqsnlvvpntvkntdgslvtpeiisdd
    gdyekpnvkwhlpeftnevsfifyqpvtigkakarfhgrvtqplettektvnltryvkyi
    rgnagiyklprednslkqgtlashrckaltvdrearnggklwyrlknigwtkaenlsldr
    ydkmeydkgvtayarvrnasgnsvwtkpyntagakhvnklsvyqgknmrilreaktpitt
    wyqfsiggkvigwvdtralntfykqsmekptrltryvsankagesyykvpvadnpvkrgt
    lakyknqklivdcqatiegqlwyrirtsstfigwtkaanlraq