PDB entry 1m9o

View 1m9o on RCSB PDB site
Description: NMR structure of the first Zinc Binding domain of Nup475/TTP/TIS11
Class: metal binding protein
Keywords: Cys3His type zinc finger, METAL BINDING PROTEIN
Deposited on 2002-07-29, released 2003-06-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tristetraproline
  Species: Mus musculus [TaxId:10090]
  Gene: Nup475
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22893 (4-End)
    • cloning artifact (3)
  Domains in SCOPe 2.06: d1m9oa1, d1m9oa2
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1m9oA (A:)
  gshmttssryktelcrtysesgrcrygakcqfahglgelrqanrhpkyktelchkfklqg
  rcpygsrchfihnpted
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1m9oA (A:)
  mttssryktelcrtysesgrcrygakcqfahglgelrqan