PDB entry 1m9o

View 1m9o on RCSB PDB site
Description: nmr structure of the first zinc binding domain of nup475/ttp/tis11
Deposited on 2002-07-29, released 2003-06-03
The last revision prior to the SCOP 1.67 freeze date was dated 2003-06-03, with a file datestamp of 2003-06-03.
Experiment type: NMR23
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1m9oa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m9oA (A:)
    gshmttssryktelcrtysesgrcrygakcqfahglgelrqanrhpkyktelchkfklqg
    rcpygsrchfihnpted
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m9oA (A:)
    mttssryktelcrtysesgrcrygakcqfahglgelrqan