PDB entry 1m9g

View 1m9g on RCSB PDB site
Description: Solution structure of G16A-MNEI, a structural mutant of single chain monellin MNEI
Class: plant protein
Keywords: 5 stranded beta sheet 1 helix, plant protein
Deposited on 2002-07-29, released 2003-06-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Monellin chain B and Monellin chain A
    Species: Dioscoreophyllum cumminsii [TaxId:3457]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02882 (1-48)
      • initiating met (0)
      • engineered (16)
      • linker (49-51)
    • Uniprot P02881 (52-96)
    Domains in SCOPe 2.07: d1m9ga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m9gA (A:)
    mgeweiidigpftqnlakfavdeenkigqygrltfnkvirpcmkktiyenegfreikgye
    yqlyvyasdklfradisedyktrgrkllrfngpvppp