PDB entry 1m98

View 1m98 on RCSB PDB site
Description: Crystal Structure of Orange Carotenoid Protein
Class: unknown function
Keywords: carotenoid binding protein, UNKNOWN FUNCTION
Deposited on 2002-07-28, released 2003-01-07
Made obsolete by 5ui2 on 2017-01-25

The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.218
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Orange Carotenoid Protein
    Species: Arthrospira maxima [TaxId:129910]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1m98a1, d1m98a2
  • Chain 'B':
    Compound: Orange Carotenoid Protein
    Species: Arthrospira maxima [TaxId:129910]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1m98b1, d1m98b2
  • Heterogens: SUC, CL, HEQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m98A (A:)
    mpftidtarsifpetlaadvvpatiarfkqlsaedqlaliwfaylemgktitiaapgaan
    mqfaentlqeirqmtplqqtqamcdlanrtdtpicrtyaswspniklgfwyelgrfmdqg
    lvapipegyklsananailvtiqgidpgqqitvlrncvvdmgfdtsklgsyqrvaepvvp
    pqemsqrtkvqiegvtnstvlqymdnlnandfdnlislfaedgalqppfqkpivgkentl
    rffreecqnlklipergvseptedgytqikvtgkvqtpwfggnvgmniawrfllnpenkv
    ffvaidllaspkellnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m98A (A:)
    pftidtarsifpetlaadvvpatiarfkqlsaedqlaliwfaylemgktitiaapgaanm
    qfaentlqeirqmtplqqtqamcdlanrtdtpicrtyaswspniklgfwyelgrfmdqgl
    vapipegyklsananailvtiqgidpgqqitvlrncvvdmgfdtsklgsyqrvaepvvpp
    qemsqrtkvqiegvtnstvlqymdnlnandfdnlislfaedgalqppfqkpivgkentlr
    ffreecqnlklipergvseptedgytqikvtgkvqtpwfggnvgmniawrfllnpenkvf
    fvaidllaspkellnl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m98B (B:)
    mpftidtarsifpetlaadvvpatiarfkqlsaedqlaliwfaylemgktitiaapgaan
    mqfaentlqeirqmtplqqtqamcdlanrtdtpicrtyaswspniklgfwyelgrfmdqg
    lvapipegyklsananailvtiqgidpgqqitvlrncvvdmgfdtsklgsyqrvaepvvp
    pqemsqrtkvqiegvtnstvlqymdnlnandfdnlislfaedgalqppfqkpivgkentl
    rffreecqnlklipergvseptedgytqikvtgkvqtpwfggnvgmniawrfllnpenkv
    ffvaidllaspkellnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m98B (B:)
    pftidtarsifpetlaadvvpatiarfkqlsaedqlaliwfaylemgktitiaapgaanm
    qfaentlqeirqmtplqqtqamcdlanrtdtpicrtyaswspniklgfwyelgrfmdqgl
    vapipegyklsananailvtiqgidpgqqitvlrncvvdmgfdtsklgsyqrvaepvvpp
    qemsqrtkvqiegvtnstvlqymdnlnandfdnlislfaedgalqppfqkpivgkentlr
    ffreecqnlklipergvseptedgytqikvtgkvqtpwfggnvgmniawrfllnpenkvf
    fvaidllaspkell