PDB entry 1m98

View 1m98 on RCSB PDB site
Description: crystal structure of orange carotenoid protein
Deposited on 2002-07-28, released 2003-01-07
Made obsolete by 5ui2 on 2017-01-25

The last revision prior to the SCOP 1.63 freeze date was dated 2003-01-07, with a file datestamp of 2003-01-07.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.218
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m98A (A:)
    pftidtarsifpetlaadvvpatiarfkqlsaedqlaliwfaylemgktitiaapgaanm
    qfaentlqeirqmtplqqtqamcdlanrtdtpicrtyaswspniklgfwyelgrfmdqgl
    vapipegyklsananailvtiqgidpgqqitvlrncvvdmgfdtsklgsyqrvaepvvpp
    qemsqrtkvqiegvtnstvlqymdnlnandfdnlislfaedgalqppfqkpivgkentlr
    ffreecqnlklipergvseptedgytqikvtgkvqtpwfggnvgmniawrfllnpenkvf
    fvaidllaspkellnl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m98B (B:)
    pftidtarsifpetlaadvvpatiarfkqlsaedqlaliwfaylemgktitiaapgaanm
    qfaentlqeirqmtplqqtqamcdlanrtdtpicrtyaswspniklgfwyelgrfmdqgl
    vapipegyklsananailvtiqgidpgqqitvlrncvvdmgfdtsklgsyqrvaepvvpp
    qemsqrtkvqiegvtnstvlqymdnlnandfdnlislfaedgalqppfqkpivgkentlr
    ffreecqnlklipergvseptedgytqikvtgkvqtpwfggnvgmniawrfllnpenkvf
    fvaidllaspkell