PDB entry 1m94

View 1m94 on RCSB PDB site
Description: Solution Structure of the Yeast Ubiquitin-Like Modifier Protein Hub1
Class: structural genomics, signaling protein
Keywords: ubiquitin-like fold or beta-grasp fold, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, SIGNALING PROTEIN
Deposited on 2002-07-26, released 2002-12-11
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: 0.14
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein YNR032c-a
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YNR032c-a/HUB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1m94a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m94A (A:)
    mgsshhhhhhssglvprgshmievvvndrlgkkvrvkclaedsvgdfkkvlslqigtqpn
    kivlqkggsvlkdhisledyevhdqtnlelyyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m94A (A:)
    mievvvndrlgkkvrvkclaedsvgdfkkvlslqigtqpnkivlqkggsvlkdhisledy
    evhdqtnlelyyl