PDB entry 1m8u

View 1m8u on RCSB PDB site
Description: Crystal Structure of Bovine gamma-E at 1.65 Ang Resolution
Class: structural protein
Keywords: gamma-crystallin, gamma-E, crystal structure, STRUCTURAL PROTEIN
Deposited on 2002-07-26, released 2003-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.186
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gamma-E
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m8ua1, d1m8ua2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m8uA (A:)
    gkitfyedrgfqgrhyecssdhsnlqpyfsrcnsirvdsgcwmiyeqpnfqgpqyflrrg
    dypdyqqwmglndsirscrliphtsshrlriyeredyrgqmveitedcsslherfhfsei
    hsfhvlegwwvlyempnyrgrqyllrpgdyrryhewgavdarvgslrravdfy