PDB entry 1m8s

View 1m8s on RCSB PDB site
Description: Crystal Structures of Cadmium-binding Acidic Phospholipase A2 from the Venom of Agkistrodon halys pallas at 1.9 Resolution (crystal grown at pH 5.9)
Class: Hydrolase
Keywords: phopholipase a2-metal cation complex, three alpha, two beta, Hydrolase
Deposited on 2002-07-25, released 2003-02-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.202
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Gloydius halys [TaxId:8714]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14418 (0-123)
      • see remark 999 (2)
      • see remark 999 (18)
      • see remark 999 (100-101)
    Domains in SCOPe 2.08: d1m8sa_
  • Heterogens: CD, BU1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1m8sA (A:)
slvqfetlimkvakksgmqwysnygcycgwggqgrpqdatdrccfvhdccygkvtgcdpk
mdvysfseengdivcggddpckkeicecdraaaicfrdnlntyndkkywafgakncpqee
sepc