PDB entry 1m8r

View 1m8r on RCSB PDB site
Description: Crystal Structures of Cadmium-binding Acidic Phospholipase A2 from the Venom of Agkistrodon halys pallas at 1.9 Resolution (crystal grown at pH 7.4)
Deposited on 2002-07-25, released 2003-02-11
The last revision prior to the SCOP 1.69 freeze date was dated 2003-02-11, with a file datestamp of 2003-02-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.193
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1m8ra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m8rA (A:)
    slvqfetlimkvakksgmqwysnygcycgwggqgrpqdatdrccfvhdccygkvtgcdpk
    mdvysfseengdivcggddpckkeicecdraaaicfrdnlntyndkkywafgakncpqee
    sepc