PDB entry 1m8m

View 1m8m on RCSB PDB site
Description: solid-state mas nmr structure of the a-spectrin sh3 domain
Class: structural protein
Keywords: solid-state mas nmr structure
Deposited on 2002-07-25, released 2002-11-20
The last revision prior to the SCOP 1.75 freeze date was dated 2002-11-20, with a file datestamp of 2007-06-04.
Experiment type: NMR12
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spectrin alpha chain, brain
    Species: GALLUS GALLUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1m8ma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1m8mA (A:)
mdetgkelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkk
ld

    Sequence, based on observed residues (ATOM records): (download) 
    >1m8mA (A:)
elvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkkld