PDB entry 1m8m

View 1m8m on RCSB PDB site
Description: solid-state mas nmr structure of the a-spectrin sh3 domain
Deposited on 2002-07-25, released 2002-11-20
The last revision prior to the SCOP 1.69 freeze date was dated 2002-11-20, with a file datestamp of 2002-11-20.
Experiment type: NMR12
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1m8ma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m8mA (A:)
    mdetgkelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkk
    ld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m8mA (A:)
    elvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkkld