PDB entry 1m8b

View 1m8b on RCSB PDB site
Description: solution structure of the c state of turkey ovomucoid at ph 2.5
Deposited on 2002-07-24, released 2002-09-04
The last revision prior to the SCOP 1.69 freeze date was dated 2002-09-04, with a file datestamp of 2002-09-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1m8ba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m8bA (A:)
    laavsvdcseypkdactleyrplcgsdnktygnkcnfcnavvesngtltlshfgkc