PDB entry 1m8b

View 1m8b on RCSB PDB site
Description: Solution structure of the C State of turkey ovomucoid at pH 2.5
Class: hydrolase inhibitor
Keywords: omtky3 conformational transition cis-trans isomerization, hydrolase inhibitor
Deposited on 2002-07-24, released 2002-09-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ovomucoid
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01004 (0-55)
      • engineered (13)
    Domains in SCOPe 2.08: d1m8ba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m8bA (A:)
    laavsvdcseypkdactleyrplcgsdnktygnkcnfcnavvesngtltlshfgkc