PDB entry 1m8a

View 1m8a on RCSB PDB site
Description: Human MIP-3alpha/CCL20
Class: cytokine
Keywords: CC-chemokine, IL-8 type dimer, CYTOKINE
Deposited on 2002-07-24, released 2002-07-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.19
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Small inducible cytokine A20
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1m8aa_
  • Chain 'B':
    Compound: Small inducible cytokine A20
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1m8ab_
  • Heterogens: IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m8aA (A:)
    asnfdcclgytdrilhpkfivgftrqlanegcdinaiifhtkkklsvcanpkqtwvkyiv
    rllskkvknm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m8aA (A:)
    dcclgytdrilhpkfivgftrqlanegcdinaiifhtkkklsvcanpkqtwvkyivrlls
    k
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m8aB (B:)
    asnfdcclgytdrilhpkfivgftrqlanegcdinaiifhtkkklsvcanpkqtwvkyiv
    rllskkvknm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m8aB (B:)
    dcclgytdrilhpkfivgftrqlanegcdinaiifhtkkklsvcanpkqtwvkyivrlls
    k