PDB entry 1m85

View 1m85 on RCSB PDB site
Description: Structure of Proteus mirabilis catalase for the native form
Class: oxidoreductase
Keywords: Methionine sulfone, OXIDOREDUCTASE
Deposited on 2002-07-24, released 2002-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-16, with a file datestamp of 2014-04-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: catalase
    Species: Proteus mirabilis [TaxId:584]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m85a_
  • Heterogens: SO4, HEM, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m85A (A:)
    mekkklttaagapvvdnnnvitagprgpmllqdvwfleklahfdreviperrmhakgsga
    fgtftvthditkytrakifsevgkktemfarfstvagergaadaerdirgfalkfyteeg
    nwdmvgnntpvfylrdplkfpdlnhivkrdprtnmrnmaykwdffshlpeslhqltidms
    drglplsyrfvhgfgshtysfinkdnerfwvkfhfrcqqgiknlmddeaealvgkdress
    qrdlfeaiergdyprwklqiqimpekeastvpynpfdltkvwphadyplmdvgyfelnrn
    pdnyfsdveqaafspanivpgisfspdkmlqgrlfsygdahryrlgvnhhqipvnapkcp
    fhnyhrdgamrvdgnsgngityepnsggvfqeqpdfkepplsiegaadhwnhrededyfs
    qpralyellsddehqrmfariagelsqasketqqrqidlftkvhpeygagvekaikvleg
    kdak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m85A (A:)
    kklttaagapvvdnnnvitagprgpmllqdvwfleklahfdreviperrmhakgsgafgt
    ftvthditkytrakifsevgkktemfarfstvagergaadaerdirgfalkfyteegnwd
    mvgnntpvfylrdplkfpdlnhivkrdprtnmrnmaykwdffshlpeslhqltidmsdrg
    lplsyrfvhgfgshtysfinkdnerfwvkfhfrcqqgiknlmddeaealvgkdressqrd
    lfeaiergdyprwklqiqimpekeastvpynpfdltkvwphadyplmdvgyfelnrnpdn
    yfsdveqaafspanivpgisfspdkmlqgrlfsygdahryrlgvnhhqipvnapkcpfhn
    yhrdgamrvdgnsgngityepnsggvfqeqpdfkepplsiegaadhwnhrededyfsqpr
    alyellsddehqrmfariagelsqasketqqrqidlftkvhpeygagvekaikvle