PDB entry 1m83

View 1m83 on RCSB PDB site
Description: Crystal Structure of Tryptophanyl-tRNA Synthetase Complexed with ATP in a Closed, Pre-transition State Conformation
Deposited on 2002-07-24, released 2002-12-18
The last revision prior to the SCOP 1.71 freeze date was dated 2002-12-18, with a file datestamp of 2002-12-18.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1m83a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m83A (A:)
    mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
    laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsa
    glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
    arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
    llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
    degaekanrvasemvrkmeqamglgrrr