PDB entry 1m80

View 1m80 on RCSB PDB site
Description: substrate free form of arginine kinase
Deposited on 2002-07-23, released 2002-12-31
The last revision prior to the SCOP 1.63 freeze date was dated 2002-12-31, with a file datestamp of 2002-12-31.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.223
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m80A (A:)
    vdqatldkleagfkklqeasdcksllkkhltkdvfdsiknkktgmgatlldviqsgvenl
    dsgvgiyapdaesyrtfgplfdpiiddyhggfkltdkhppkqwgdintlvgldpagqfii
    strvrcgrslqgypfnpcltaeqykemeekvsstlssmedelkgtyypltgmskatqqql
    iddhflfkegdrflqtanacrywptgrgifhndaktflvwvneedhlriismqkggdlkt
    vykrlvtavdniesklpfshddrfgfltfcptnlgttmrasvhiqlpklakdrkvledia
    skfnlqvrgtrgehteseggvydisnkrrlglteyqavremqdgilemikmekaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m80A (A:)
    vdqatldkleagfkklqeasdcksllkkhltkdvfdsiknkktgmgatlldviqsgvenl
    dsgvgiyapdaesyrtfgplfdpiiddyhggfkltdkhppkqwgdintlvgldpagqfii
    strvrcgrslqgypfnpcltaeqykemeekvsstlssmedelkgtyypltgmskatqqql
    iddhflfkegdrflqtanacrywptgrgifhndaktflvwvneedhlriismqkggdlkt
    vykrlvtavdniesklpfshddrfgfltfcptnlgttmrasvhiqlpklakdrkvledia
    skfnlqvgvydisnkrrlglteyqavremqdgilemikmekaaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m80B (B:)
    vdqatldkleagfkklqeasdcksllkkhltkdvfdsiknkktgmgatlldviqsgvenl
    dsgvgiyapdaesyrtfgplfdpiiddyhggfkltdkhppkqwgdintlvgldpagqfii
    strvrcgrslqgypfnpcltaeqykemeekvsstlssmedelkgtyypltgmskatqqql
    iddhflfkegdrflqtanacrywptgrgifhndaktflvwvneedhlriismqkggdlkt
    vykrlvtavdniesklpfshddrfgfltfcptnlgttmrasvhiqlpklakdrkvledia
    skfnlqvrgtrgehteseggvydisnkrrlglteyqavremqdgilemikmekaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m80B (B:)
    vdqatldkleagfkklqeasdcksllkkhltkdvfdsiknkktgmgatlldviqsgvenl
    dsgvgiyapdaesyrtfgplfdpiiddyhggfkltdkhppkqwgdintlvgldpagqfii
    strvrcgrslqgypfnpcltaeqykemeekvsstlssmedelkgtyypltgmskatqqql
    iddhflfkegdrflqtanacrywptgrgifhndaktflvwvneedhlriismqkggdlkt
    vykrlvtavdniesklpfshddrfgfltfcptnlgttmrasvhiqlpklakdrkvledia
    skfnlqvgvydisnkrrlglteyqavremqdgilemikmekaaa