PDB entry 1m80

View 1m80 on RCSB PDB site
Description: substrate free form of arginine kinase
Class: transferase
Keywords: induced fit, arginine kinase, creatine kinase, guanidino kina structure, transferase
Deposited on 2002-07-23, released 2002-12-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-03-16, with a file datestamp of 2010-03-12.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.223
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arginine kinase
    Species: Limulus polyphemus [TaxId:6850]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51541 (Start-356)
      • engineered (102)
      • engineered (111)
      • engineered (115)
    Domains in SCOPe 2.07: d1m80a3, d1m80a4
  • Chain 'B':
    Compound: arginine kinase
    Species: Limulus polyphemus [TaxId:6850]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51541 (Start-356)
      • engineered (102)
      • engineered (111)
      • engineered (115)
    Domains in SCOPe 2.07: d1m80b3, d1m80b4
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m80A (A:)
    mvdqatldkleagfkklqeasdcksllkkhltkdvfdsiknkktgmgatlldviqsgven
    ldsgvgiyapdaesyrtfgplfdpiiddyhggfkltdkhppkqwgdintlvgldpagqfi
    istrvrcgrslqgypfnpcltaeqykemeekvsstlssmedelkgtyypltgmskatqqq
    liddhflfkegdrflqtanacrywptgrgifhndaktflvwvneedhlriismqkggdlk
    tvykrlvtavdniesklpfshddrfgfltfcptnlgttmrasvhiqlpklakdrkvledi
    askfnlqvrgtrgehteseggvydisnkrrlglteyqavremqdgilemikmekaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m80A (A:)
    vdqatldkleagfkklqeasdcksllkkhltkdvfdsiknkktgmgatlldviqsgvenl
    dsgvgiyapdaesyrtfgplfdpiiddyhggfkltdkhppkqwgdintlvgldpagqfii
    strvrcgrslqgypfnpcltaeqykemeekvsstlssmedelkgtyypltgmskatqqql
    iddhflfkegdrflqtanacrywptgrgifhndaktflvwvneedhlriismqkggdlkt
    vykrlvtavdniesklpfshddrfgfltfcptnlgttmrasvhiqlpklakdrkvledia
    skfnlqvgvydisnkrrlglteyqavremqdgilemikmekaaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m80B (B:)
    mvdqatldkleagfkklqeasdcksllkkhltkdvfdsiknkktgmgatlldviqsgven
    ldsgvgiyapdaesyrtfgplfdpiiddyhggfkltdkhppkqwgdintlvgldpagqfi
    istrvrcgrslqgypfnpcltaeqykemeekvsstlssmedelkgtyypltgmskatqqq
    liddhflfkegdrflqtanacrywptgrgifhndaktflvwvneedhlriismqkggdlk
    tvykrlvtavdniesklpfshddrfgfltfcptnlgttmrasvhiqlpklakdrkvledi
    askfnlqvrgtrgehteseggvydisnkrrlglteyqavremqdgilemikmekaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m80B (B:)
    vdqatldkleagfkklqeasdcksllkkhltkdvfdsiknkktgmgatlldviqsgvenl
    dsgvgiyapdaesyrtfgplfdpiiddyhggfkltdkhppkqwgdintlvgldpagqfii
    strvrcgrslqgypfnpcltaeqykemeekvsstlssmedelkgtyypltgmskatqqql
    iddhflfkegdrflqtanacrywptgrgifhndaktflvwvneedhlriismqkggdlkt
    vykrlvtavdniesklpfshddrfgfltfcptnlgttmrasvhiqlpklakdrkvledia
    skfnlqvgvydisnkrrlglteyqavremqdgilemikmekaaa