PDB entry 1m7y

View 1m7y on RCSB PDB site
Description: Crystal structure of apple ACC synthase in complex with L-aminoethoxyvinylglycine
Class: lyase
Keywords: Fruit ripening, Ethylene biosynthesis, Pyridoxal phosphate, LYASE
Deposited on 2002-07-23, released 2002-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.205
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-aminocyclopropane-1-carboxylate synthase
    Species: Malus x domestica [TaxId:3750]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m7ya_
  • Heterogens: PPG, MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m7yA (A:)
    mrmlsrnatfnshgqdssyflgwqeyeknpyhevhntngiiqmglaenqlcfdlleswla
    knpeaaafkkngesifaelalfqdyhglpafkkamvdfmaeirgnkvtfdpnhlvltaga
    tsanetfifcladpgeavliptpyypgfdrdlkwrtgveivpihctssngfqitetalee
    ayqeaekrnlrvkgvlvtnpsnplgttmtrnelylllsfvedkgihlisdeiysgtafss
    psfisvmevlkdrncdensevwqrvhvvyslskdlglpgfrvgaiysnddmvvaaatkms
    sfglvssqtqhllsamlsdkkltknyiaenhkrlkqrqkklvsglqksgisclngnaglf
    cwvdmrhllrsntfeaemelwkkivyevhlnispgsschctepgwfrvcfanlpertldl
    amqrlkafvgeyynv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m7yA (A:)
    mlsrnatssyflgwqeyeknpyhevhntngiiqmglaenqlcfdlleswlaknpeaaafk
    kngesifaelalfqdyhglpafkkamvdfmaeirgnkvtfdpnhlvltagatsanetfif
    cladpgeavliptpyypgfdrdlkwrtgveivpihctssngfqitetaleeayqeaekrn
    lrvkgvlvtnpsnplgttmtrnelylllsfvedkgihlisdeiysgtafsspsfisvmev
    lkdrncdensevwqrvhvvyslskdlglpgfrvgaiysnddmvvaaatkmssfglvssqt
    qhllsamlsdkkltknyiaenhkrlkqrqkklvsglqksgisclngnaglfcwvdmrhll
    rsntfeaemelwkkivyevhlnispgsschctepgwfrvcfanlpertldlamqrlkafv
    geyy