PDB entry 1m7w

View 1m7w on RCSB PDB site
Description: HNF4a ligand binding domain with bound fatty acid
Class: transcription factor
Keywords: Transcription factor
Deposited on 2002-07-22, released 2003-07-01
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.237
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte nuclear factor 4-alpha
    Species: Rattus rattus [TaxId:10117]
    Gene: HNF4a
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1m7wa_
  • Chain 'B':
    Compound: Hepatocyte nuclear factor 4-alpha
    Species: Rattus rattus [TaxId:10117]
    Gene: HNF4a
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1m7wb_
  • Chain 'C':
    Compound: Hepatocyte nuclear factor 4-alpha
    Species: Rattus rattus [TaxId:10117]
    Gene: HNF4a
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1m7wc_
  • Chain 'D':
    Compound: Hepatocyte nuclear factor 4-alpha
    Species: Rattus rattus [TaxId:10117]
    Gene: HNF4a
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1m7wd_
  • Heterogens: DAO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m7wA (A:)
    ssyedsslpsinallqaevlsqqitspisgingdirakriasitdvcesmkeqllvlvew
    akyipafcelllddqvallrahagehlllgatkrsmvfkdvlllgndyivprhcpelaem
    srvsirildelvlpfqelqiddneyaclkaiiffdpdakglsdpgkikrlrsqvqvsled
    yindrqydsrgrfgelllllptlqsitwqmieqiqfiklfgmakidnllqemllggsasd
    aphahhplhp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m7wA (A:)
    sinallqaevlsqqitspisgdirakriasitdvcesmkeqllvlvewakyipafcelll
    ddqvallrahagehlllgatkrsmvfkdvlllgndyivprhcpelaemsrvsirildelv
    lpfqelqiddneyaclkaiiffdpdakglsdpgkikrlrsqvqvsledyindrqydsrgr
    fgelllllptlqsitwqmieqiqfiklfgmakidnllqemllg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m7wB (B:)
    ssyedsslpsinallqaevlsqqitspisgingdirakriasitdvcesmkeqllvlvew
    akyipafcelllddqvallrahagehlllgatkrsmvfkdvlllgndyivprhcpelaem
    srvsirildelvlpfqelqiddneyaclkaiiffdpdakglsdpgkikrlrsqvqvsled
    yindrqydsrgrfgelllllptlqsitwqmieqiqfiklfgmakidnllqemllggsasd
    aphahhplhp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m7wB (B:)
    lpsinallqaevlsqqitrakriasitdvcesmkeqllvlvewakyipafcelllddqva
    llrahagehlllgatkrsmvfkdvlllgndyivprhcpelaemsrvsirildelvlpfqe
    lqiddneyaclkaiiffdpdakglsdpgkikrlrsqvqvsledyindrqydsrgrfgell
    lllptlqsitwqmieqiqfiklfgmakidnllqemllg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1m7wC (C:)
    ssyedsslpsinallqaevlsqqitspisgingdirakriasitdvcesmkeqllvlvew
    akyipafcelllddqvallrahagehlllgatkrsmvfkdvlllgndyivprhcpelaem
    srvsirildelvlpfqelqiddneyaclkaiiffdpdakglsdpgkikrlrsqvqvsled
    yindrqydsrgrfgelllllptlqsitwqmieqiqfiklfgmakidnllqemllggsasd
    aphahhplhp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m7wC (C:)
    lpsinallqaevlsqqitsirakriasitdvcesmkeqllvlvewakyipafcelllddq
    vallrahagehlllgatkrsmvfkdvlllgndyivprhcpelaemsrvsirildelvlpf
    qelqiddneyaclkaiiffdpdakglsdpgkikrlrsqvqvsledyindrqydsrgrfge
    lllllptlqsitwqmieqiqfiklfgmakidnllqemllg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1m7wD (D:)
    ssyedsslpsinallqaevlsqqitspisgingdirakriasitdvcesmkeqllvlvew
    akyipafcelllddqvallrahagehlllgatkrsmvfkdvlllgndyivprhcpelaem
    srvsirildelvlpfqelqiddneyaclkaiiffdpdakglsdpgkikrlrsqvqvsled
    yindrqydsrgrfgelllllptlqsitwqmieqiqfiklfgmakidnllqemllggsasd
    aphahhplhp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m7wD (D:)
    slpsinallqaevlsqqitsirakriasitdvcesmkeqllvlvewakyipafcellldd
    qvallrahagehlllgatkrsmvfkdvlllgndyivprhcpelaemsrvsirildelvlp
    fqelqiddneyaclkaiiffdpdakglsdpgkikrlrsqvqvsledyindrqydsrgrfg
    elllllptlqsitwqmieqiqfiklfgmakidnllqemllg