PDB entry 1m7r

View 1m7r on RCSB PDB site
Description: crystal structure of myotubularin-related protein-2 (mtmr2) complexed with phosphate
Deposited on 2002-07-22, released 2003-10-07
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-03, with a file datestamp of 2004-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.207
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m7rA (A:)
    masmetsssceslgsqpaaarppsvdslssastshsensvhtksasvvssdsistsadnf
    spdlrvlresnklaemeeppllpgenikdmakdvtyicpftgavrgtltvtnyrlyfksm
    erdppfvldaslgvinrvekiggassrgensygletvckdirnlrfahkpegrtrrsife
    nlmkyafpvsnnlplfafeykevfpengwklydplleyrrqgipneswritkineryelc
    dtypallvvpanipdeelkrvasfrsrgripvlswihpesqatitrcsqpmvgvsgkrsk
    edekylqaimdsnaqshkififdarpsvnavankakgggyesedayqnaelvfldihnih
    vmreslrklkeivypnieethwlsnlesthwlehiklilagalriadkvesgktsvvvhs
    sdgwdrtaqltslamlmldgyyrtirgfevlvekewlsfghrfqlrvghgdknhadadrs
    pvflqfidcvwqmtrqfptafefneyflitildhlysclfgtflcnseqqrgkenlpkrt
    vslwsyinsqledftnplygsysnhvlypvasmrhlelwvgyyirwnprmkpqepihnry
    kellakraelqkkveelqreisnrstssserasspaqcvtpvqtvvaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m7rA (A:)
    eeppllpgenikdmakdvtyicpftgavrgtltvtnyrlyfksmerdppfvldaslgvin
    rvekiggassrgensygletvckdirnlrfahkpegrtrrsifenlmkyafpvsnnlplf
    afeykevfpengwklydplleyrrqgipneswritkineryelcdtypallvvpanipde
    elkrvasfrsrgripvlswihpesqatitrcsqpmvgvsgkrskedekylqaimdsnaqs
    hkififdarpsvnavankakgggyesedayqnaelvfldihnihvmreslrklkeivypn
    ieethwlsnlesthwlehiklilagalriadkvesgktsvvvhssdgwdrtaqltslaml
    mldgyyrtirgfevlvekewlsfghrfqlrvghgdknhadadrspvflqfidcvwqmtrq
    fptafefneyflitildhlysclfgtflcnseqqrgkenlpkrtvslwsyinsqledftn
    plygsysnhvlypvasmrhlelwvgyyirwnpr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m7rB (B:)
    masmetsssceslgsqpaaarppsvdslssastshsensvhtksasvvssdsistsadnf
    spdlrvlresnklaemeeppllpgenikdmakdvtyicpftgavrgtltvtnyrlyfksm
    erdppfvldaslgvinrvekiggassrgensygletvckdirnlrfahkpegrtrrsife
    nlmkyafpvsnnlplfafeykevfpengwklydplleyrrqgipneswritkineryelc
    dtypallvvpanipdeelkrvasfrsrgripvlswihpesqatitrcsqpmvgvsgkrsk
    edekylqaimdsnaqshkififdarpsvnavankakgggyesedayqnaelvfldihnih
    vmreslrklkeivypnieethwlsnlesthwlehiklilagalriadkvesgktsvvvhs
    sdgwdrtaqltslamlmldgyyrtirgfevlvekewlsfghrfqlrvghgdknhadadrs
    pvflqfidcvwqmtrqfptafefneyflitildhlysclfgtflcnseqqrgkenlpkrt
    vslwsyinsqledftnplygsysnhvlypvasmrhlelwvgyyirwnprmkpqepihnry
    kellakraelqkkveelqreisnrstssserasspaqcvtpvqtvvaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m7rB (B:)
    eeppllpgenikdmakdvtyicpftgavrgtltvtnyrlyfksmerdppfvldaslgvin
    rvekiggassrgensygletvckdirnlrfahkpegrtrrsifenlmkyafpvsnnlplf
    afeykevfpengwklydplleyrrqgipneswritkineryelcdtypallvvpanipde
    elkrvasfrsrgripvlswihpesqatitrcsqpmvgvsgkrskedekylqaimdsnaqs
    hkififdarpsvnavankakgggyesedayqnaelvfldihnihvmreslrklkeivypn
    ieethwlsnlesthwlehiklilagalriadkvesgktsvvvhssdgwdrtaqltslaml
    mldgyyrtirgfevlvekewlsfghrfqlrvghgdknhadadrspvflqfidcvwqmtrq
    fptafefneyflitildhlysclfgtflcnseqqrgkenlpkrtvslwsyinsqledftn
    plygsysnhvlypvasmrhlelwvgyyirwnpr