PDB entry 1m7r

View 1m7r on RCSB PDB site
Description: Crystal Structure of Myotubularin-related Protein-2 (MTMR2) Complexed with Phosphate
Class: hydrolase
Keywords: Protein-phosphate complex, HYDROLASE
Deposited on 2002-07-22, released 2003-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.207
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myotubularin-related Protein-2
    Species: Homo sapiens [TaxId:9606]
    Gene: MTMR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13614
      • engineered (419)
    Domains in SCOPe 2.07: d1m7ra1, d1m7ra2
  • Chain 'B':
    Compound: Myotubularin-related Protein-2
    Species: Homo sapiens [TaxId:9606]
    Gene: MTMR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13614
      • engineered (419)
    Domains in SCOPe 2.07: d1m7rb1, d1m7rb2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m7rA (A:)
    masmetsssceslgsqpaaarppsvdslssastshsensvhtksasvvssdsistsadnf
    spdlrvlresnklaemeeppllpgenikdmakdvtyicpftgavrgtltvtnyrlyfksm
    erdppfvldaslgvinrvekiggassrgensygletvckdirnlrfahkpegrtrrsife
    nlmkyafpvsnnlplfafeykevfpengwklydplleyrrqgipneswritkineryelc
    dtypallvvpanipdeelkrvasfrsrgripvlswihpesqatitrcsqpmvgvsgkrsk
    edekylqaimdsnaqshkififdarpsvnavankakgggyesedayqnaelvfldihnih
    vmreslrklkeivypnieethwlsnlesthwlehiklilagalriadkvesgktsvvvhs
    sdgwdrtaqltslamlmldgyyrtirgfevlvekewlsfghrfqlrvghgdknhadadrs
    pvflqfidcvwqmtrqfptafefneyflitildhlysclfgtflcnseqqrgkenlpkrt
    vslwsyinsqledftnplygsysnhvlypvasmrhlelwvgyyirwnprmkpqepihnry
    kellakraelqkkveelqreisnrstssserasspaqcvtpvqtvvaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m7rA (A:)
    eeppllpgenikdmakdvtyicpftgavrgtltvtnyrlyfksmerdppfvldaslgvin
    rvekiggassrgensygletvckdirnlrfahkpegrtrrsifenlmkyafpvsnnlplf
    afeykevfpengwklydplleyrrqgipneswritkineryelcdtypallvvpanipde
    elkrvasfrsrgripvlswihpesqatitrcsqpmvgvsgkrskedekylqaimdsnaqs
    hkififdarpsvnavankakgggyesedayqnaelvfldihnihvmreslrklkeivypn
    ieethwlsnlesthwlehiklilagalriadkvesgktsvvvhssdgwdrtaqltslaml
    mldgyyrtirgfevlvekewlsfghrfqlrvghgdknhadadrspvflqfidcvwqmtrq
    fptafefneyflitildhlysclfgtflcnseqqrgkenlpkrtvslwsyinsqledftn
    plygsysnhvlypvasmrhlelwvgyyirwnpr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m7rB (B:)
    masmetsssceslgsqpaaarppsvdslssastshsensvhtksasvvssdsistsadnf
    spdlrvlresnklaemeeppllpgenikdmakdvtyicpftgavrgtltvtnyrlyfksm
    erdppfvldaslgvinrvekiggassrgensygletvckdirnlrfahkpegrtrrsife
    nlmkyafpvsnnlplfafeykevfpengwklydplleyrrqgipneswritkineryelc
    dtypallvvpanipdeelkrvasfrsrgripvlswihpesqatitrcsqpmvgvsgkrsk
    edekylqaimdsnaqshkififdarpsvnavankakgggyesedayqnaelvfldihnih
    vmreslrklkeivypnieethwlsnlesthwlehiklilagalriadkvesgktsvvvhs
    sdgwdrtaqltslamlmldgyyrtirgfevlvekewlsfghrfqlrvghgdknhadadrs
    pvflqfidcvwqmtrqfptafefneyflitildhlysclfgtflcnseqqrgkenlpkrt
    vslwsyinsqledftnplygsysnhvlypvasmrhlelwvgyyirwnprmkpqepihnry
    kellakraelqkkveelqreisnrstssserasspaqcvtpvqtvvaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m7rB (B:)
    eeppllpgenikdmakdvtyicpftgavrgtltvtnyrlyfksmerdppfvldaslgvin
    rvekiggassrgensygletvckdirnlrfahkpegrtrrsifenlmkyafpvsnnlplf
    afeykevfpengwklydplleyrrqgipneswritkineryelcdtypallvvpanipde
    elkrvasfrsrgripvlswihpesqatitrcsqpmvgvsgkrskedekylqaimdsnaqs
    hkififdarpsvnavankakgggyesedayqnaelvfldihnihvmreslrklkeivypn
    ieethwlsnlesthwlehiklilagalriadkvesgktsvvvhssdgwdrtaqltslaml
    mldgyyrtirgfevlvekewlsfghrfqlrvghgdknhadadrspvflqfidcvwqmtrq
    fptafefneyflitildhlysclfgtflcnseqqrgkenlpkrtvslwsyinsqledftn
    plygsysnhvlypvasmrhlelwvgyyirwnpr