PDB entry 1m7l

View 1m7l on RCSB PDB site
Description: Solution Structure of the Coiled-Coil Trimerization Domain from Lung Surfactant Protein D
Class: sugar binding protein
Keywords: coiled coil, lung surfactant protein, trimer, ambiguous distance restraints, NMR-spectroscopy, SUGAR BINDING PROTEIN
Deposited on 2002-07-22, released 2002-11-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pulmonary surfactant-associated protein D
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35247
    • cloning artifact (38-39)
  Domains in SCOPe 2.05: d1m7la_
• Chain 'B':
  Compound: Pulmonary surfactant-associated protein D
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35247
    • cloning artifact (38-39)
  Domains in SCOPe 2.05: d1m7lb_
• Chain 'C':
  Compound: Pulmonary surfactant-associated protein D
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35247 (0-37)
    • cloning artifact (38-39)
  Domains in SCOPe 2.05: d1m7lc_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1m7lA (A:)
  glpdvaslrqqvealqgqvqhlqaafsqykkvelfpnggi
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1m7lB (B:)
  glpdvaslrqqvealqgqvqhlqaafsqykkvelfpnggi
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1m7lC (C:)
  glpdvaslrqqvealqgqvqhlqaafsqykkvelfpnggi