PDB entry 1m7l

View 1m7l on RCSB PDB site
Description: Solution Structure of the Coiled-Coil Trimerization Domain from Lung Surfactant Protein D
Class: sugar binding protein
Keywords: coiled coil, lung surfactant protein, trimer, ambiguous distance restraints, NMR-spectroscopy
Deposited on 2002-07-22, released 2002-11-27
The last revision prior to the SCOP 1.75 freeze date was dated 2002-11-27, with a file datestamp of 2007-06-04.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pulmonary surfactant-associated protein D
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35247
      • cloning artifact (38-39)
    Domains in SCOP 1.75: d1m7la_
  • Chain 'B':
    Compound: Pulmonary surfactant-associated protein D
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35247
      • cloning artifact (38-39)
    Domains in SCOP 1.75: d1m7lb_
  • Chain 'C':
    Compound: Pulmonary surfactant-associated protein D
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35247 (0-37)
      • cloning artifact (38-39)
    Domains in SCOP 1.75: d1m7lc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m7lA (A:)
    glpdvaslrqqvealqgqvqhlqaafsqykkvelfpnggi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m7lB (B:)
    glpdvaslrqqvealqgqvqhlqaafsqykkvelfpnggi
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m7lC (C:)
    glpdvaslrqqvealqgqvqhlqaafsqykkvelfpnggi