PDB entry 1m7l
View 1m7l on RCSB PDB site
Description: solution structure of the coiled-coil trimerization domain from lung surfactant protein d
Deposited on
2002-07-22, released
2002-11-27
The last revision prior to the SCOP 1.67 freeze date was dated
2002-11-27, with a file datestamp of
2002-11-27.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Domains in SCOP 1.67: d1m7la_ - Chain 'B':
Domains in SCOP 1.67: d1m7lb_ - Chain 'C':
Domains in SCOP 1.67: d1m7lc_
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1m7lA (A:)
glpdvaslrqqvealqgqvqhlqaafsqykkvelfpnggi
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1m7lB (B:)
glpdvaslrqqvealqgqvqhlqaafsqykkvelfpnggi
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1m7lC (C:)
glpdvaslrqqvealqgqvqhlqaafsqykkvelfpnggi