PDB entry 1m7k

View 1m7k on RCSB PDB site
Description: Solution Structure of the SODD BAG Domain
Class: chaperone
Keywords: three helix bundle, chaperone
Deposited on 2002-07-22, released 2002-08-07
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Silencer of Death Domains
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1m7ka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m7kA (A:)
    nqdqssslpeecvpsdestppsikkiihvlekvqyleqeveefvgkktdkaywlleemlt
    kelleldsvetggqdsvrqarkeavckiqaileklekkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m7kA (A:)
    tppsikkiihvlekvqyleqeveefvgkktdkaywlleemltkelleldsvetggqdsvr
    qarkeavckiqaileklekkg