PDB entry 1m7j

View 1m7j on RCSB PDB site
Description: crystal structure of d-aminoacylase defines a novel subset of amidohydrolases
Deposited on 2002-07-22, released 2003-02-25
The last revision prior to the SCOP 1.67 freeze date was dated 2003-02-25, with a file datestamp of 2003-02-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.16
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m7jA (A:)
    msqpdatpfdyilsggtvidgtnapgrladvgvrgdriaavgdlsassarrridvagkvv
    spgfidshthddnyllkhrdmtpkisqgvttvvtgncgislaplahanppapldlldegg
    sfrfarfsdylealraappavnaacmvghstlraavmpdlrreatadeiqamqaladdal
    asgaigistgafyppaahasteeiievcrplithggvyathmrdegehivqaleetfrig
    reldvpvvishhkvmgklnfgrsketlalieaamasqdvsldaypyvagstmlkqdrvll
    agrtlitwckpypelsgrdleeiaaergkskydvvpelqpagaiyfmmdepdvqrilafg
    ptmigsdglphderphprlwgtfprvlghysrdlglfpletavwkmtgltaakfglaerg
    qvqpgyyadlvvfdpatvadsatfehpteraagihsvyvngaavwedqsftgqhagrvln
    raga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m7jA (A:)
    pfdyilsggtvidgtnapgrladvgvrgdriaavgdlsassarrridvagkvvspgfids
    hthddnyllkhrdmtpkisqgvttvvtgncgislaplahanppapldlldeggsfrfarf
    sdylealraappavnaacmvghstlraavmpdlrreatadeiqamqaladdalasgaigi
    stgafyppaahasteeiievcrplithggvyathmrdegehivqaleetfrigreldvpv
    vishhkvmgklnfgrsketlalieaamasqdvsldaypyvagstmlkqdrvllagrtlit
    wckpypelsgrdleeiaaergkskydvvpelqpagaiyfmmdepdvqrilafgptmigsd
    glphderphprlwgtfprvlghysrdlglfpletavwkmtgltaakfglaergqvqpgyy
    adlvvfdpatvadsatfehpteraagihsvyvngaavwedqsftgqhagrvlnr