PDB entry 1m7j

View 1m7j on RCSB PDB site
Description: Crystal structure of D-aminoacylase defines a novel subset of amidohydrolases
Class: hydrolase
Keywords: TIN-barrel, metal-dependent amidohydrolase, HYDROLASE
Deposited on 2002-07-22, released 2003-02-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-aminoacylase
    Species: Alcaligenes faecalis [TaxId:511]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1m7ja1, d1m7ja2, d1m7ja3
  • Heterogens: ZN, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m7jA (A:)
    msqpdatpfdyilsggtvidgtnapgrladvgvrgdriaavgdlsassarrridvagkvv
    spgfidshthddnyllkhrdmtpkisqgvttvvtgncgislaplahanppapldlldegg
    sfrfarfsdylealraappavnaacmvghstlraavmpdlrreatadeiqamqaladdal
    asgaigistgafyppaahasteeiievcrplithggvyathmrdegehivqaleetfrig
    reldvpvvishhkvmgklnfgrsketlalieaamasqdvsldaypyvagstmlkqdrvll
    agrtlitwckpypelsgrdleeiaaergkskydvvpelqpagaiyfmmdepdvqrilafg
    ptmigsdglphderphprlwgtfprvlghysrdlglfpletavwkmtgltaakfglaerg
    qvqpgyyadlvvfdpatvadsatfehpteraagihsvyvngaavwedqsftgqhagrvln
    raga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m7jA (A:)
    pfdyilsggtvidgtnapgrladvgvrgdriaavgdlsassarrridvagkvvspgfids
    hthddnyllkhrdmtpkisqgvttvvtgncgislaplahanppapldlldeggsfrfarf
    sdylealraappavnaacmvghstlraavmpdlrreatadeiqamqaladdalasgaigi
    stgafyppaahasteeiievcrplithggvyathmrdegehivqaleetfrigreldvpv
    vishhkvmgklnfgrsketlalieaamasqdvsldaypyvagstmlkqdrvllagrtlit
    wckpypelsgrdleeiaaergkskydvvpelqpagaiyfmmdepdvqrilafgptmigsd
    glphderphprlwgtfprvlghysrdlglfpletavwkmtgltaakfglaergqvqpgyy
    adlvvfdpatvadsatfehpteraagihsvyvngaavwedqsftgqhagrvlnr