PDB entry 1m7e

View 1m7e on RCSB PDB site
Description: crystal structure of the phosphotyrosine binding domain(ptb) of mouse disabled 2(dab2):implications for reeling signaling
Deposited on 2002-07-19, released 2003-08-05
The last revision prior to the SCOP 1.71 freeze date was dated 2003-11-11, with a file datestamp of 2003-11-11.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.244
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1m7ea_
  • Chain 'B':
    Domains in SCOP 1.71: d1m7eb_
  • Chain 'C':
    Domains in SCOP 1.71: d1m7ec_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m7eA (A:)
    mektdeyllarfkgdgvkykakligiddvpdargdkmsqdsmmklkgmaaagrsqgqhkq
    riwvnislsgikiidektgviehehpvnkisfiardvtdnrafgyvcggegqhqffaikt
    gqqaeplvvdlkdlfqviynvkkkeedkkkveeankaeen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m7eA (A:)
    mektdeyllarfkgdgvkykakligiddvpdargdkmsqdsmmklkgmaaagrsqgqhkq
    riwvnislsgikiidektgviehehpvnkisfiardvtdnrafgyvcggegqhqffaikt
    gqqaeplvvdlkdlfqviynvkkkeedkkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m7eB (B:)
    mektdeyllarfkgdgvkykakligiddvpdargdkmsqdsmmklkgmaaagrsqgqhkq
    riwvnislsgikiidektgviehehpvnkisfiardvtdnrafgyvcggegqhqffaikt
    gqqaeplvvdlkdlfqviynvkkkeedkkkveeankaeen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m7eB (B:)
    mektdeyllarfkgdgvkykakligiddvpdargdkmsqdsmmklkgmaaagrsqgqhkq
    riwvnislsgikiidektgviehehpvnkisfiardvtdnrafgyvcggegqhqffaikt
    gqqaeplvvdlkdlfqviynvkkkeedkkk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1m7eC (C:)
    mektdeyllarfkgdgvkykakligiddvpdargdkmsqdsmmklkgmaaagrsqgqhkq
    riwvnislsgikiidektgviehehpvnkisfiardvtdnrafgyvcggegqhqffaikt
    gqqaeplvvdlkdlfqviynvkkkeedkkkveeankaeen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m7eC (C:)
    mektdeyllarfkgdgvkykakligiddvpdargdkmsqdsmmklkgmaaagrsqgqhkq
    riwvnislsgikiidektgviehehpvnkisfiardvtdnrafgyvcggegqhqffaikt
    gqqaeplvvdlkdlfqviynvkkkeedkkk