PDB entry 1m7d

View 1m7d on RCSB PDB site
Description: Crystal structure of a Monoclonal Fab Specific for Shigella flexneri Y Lipopolysaccharide complexed with a trisaccharide
Class: immune system
Keywords: Fab-carbohydrate interactions, Shigella O-antigen, anti-carbohydrate antibody
Deposited on 2002-07-19, released 2003-07-22
The last revision prior to the SCOP 1.73 freeze date was dated 2003-07-22, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.216
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: light chain of the monoclonal antibody Fab SYA/J6
    Species: Mus musculus
    Domains in SCOP 1.73: d1m7da1, d1m7da2
  • Chain 'B':
    Compound: heavy chain of the monoclonal antibody Fab SYA/J6
    Species: Mus musculus
    Domains in SCOP 1.73: d1m7db1, d1m7db2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m7dA (A:)
    dvvltqtplslpvrlgdqasiscrssqsllhsdgntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqtthvptfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m7dB (B:)
    evkveesggglvqpggsmklscvasgftfsnywmewvrqspekglewvaeirlksnnyat
    hyaesvkgrftisrddskssvylqmnnlraedtgiyyctrggavgamdywgqgtsvtvss
    atttapsvyplvpgcsdtsgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsg
    fyslsslvtvpsstwpsqtvicnvahpaskvdlikepsgp