PDB entry 1m72

View 1m72 on RCSB PDB site
Description: Crystal Structure of Caspase-1 from Spodoptera frugiperda
Class: hydrolase/hydrolase inhibitor
Keywords: caspase, cysteine protease, hydrolase-hydrolase inhibitor complex
Deposited on 2002-07-18, released 2004-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.183
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Caspase-1
    Species: Spodoptera frugiperda [TaxId:7108]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m72a_
  • Chain 'B':
    Compound: Caspase-1
    Species: Spodoptera frugiperda [TaxId:7108]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m72b_
  • Chain 'C':
    Compound: Caspase-1
    Species: Spodoptera frugiperda [TaxId:7108]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P89116 (Start-270)
      • cloning artifact (271)
    Domains in SCOPe 2.07: d1m72c1, d1m72c2
  • Chain 'D':
    Compound: Ace-Asp-Glu-Val-Asp-chloromethylketone
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1M72 (Start-4)
  • Chain 'E':
    Compound: Ace-Asp-Glu-Val-Asp-chloromethylketone
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1M72 (Start-4)
  • Chain 'F':
    Compound: Ace-Asp-Glu-Val-Asp-chloromethylketone
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1M72 (Start-4)
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m72A (A:)
    algsnsssqpnrvarmpvdrnapyynmnhkhrgmaiifnhehfdihslksrtgtnvdsdn
    lskvlktlgfkvtvfpnlkseeinkfiqqtaemdhsdadcllvavlthgelgmlyakdth
    ykpdnlwyyftadkcptlagkpklffiqacqgdrldggitlsrtetdgspstsyripvha
    dfliafstvpgyfswrnttrgswfmqalceelryagterdiltlltfvcqkvaldfesna
    pdsammhqqkqvpcitsmltrllvfgkkqshl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m72A (A:)
    rvarmpvdrnapyynmnhkhrgmaiifnhehfdihslksrtgtnvdsdnlskvlktlgfk
    vtvfpnlkseeinkfiqqtaemdhsdadcllvavlthgelgmlyakdthykpdnlwyyft
    adkcptlagkpklffiqacqgdrldggitlsrsyripvhadfliafstvpgyfswrnttr
    gswfmqalceelryagterdiltlltfvcqkvaldfesnapdsammhqqkqvpcitsmlt
    rllvfgk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m72B (B:)
    algsnsssqpnrvarmpvdrnapyynmnhkhrgmaiifnhehfdihslksrtgtnvdsdn
    lskvlktlgfkvtvfpnlkseeinkfiqqtaemdhsdadcllvavlthgelgmlyakdth
    ykpdnlwyyftadkcptlagkpklffiqacqgdrldggitlsrtetdgspstsyripvha
    dfliafstvpgyfswrnttrgswfmqalceelryagterdiltlltfvcqkvaldfesna
    pdsammhqqkqvpcitsmltrllvfgkkqshl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m72B (B:)
    varmpvdrnapyynmnhkhrgmaiifnhehfdihslksrtgtnvdsdnlskvlktlgfkv
    tvfpnlkseeinkfiqqtaemdhsdadcllvavlthgelgmlyakdthykpdnlwyyfta
    dkcptlagkpklffiqacqgdrldggitlsrtsyripvhadfliafstvpgyfswrnttr
    gswfmqalceelryagterdiltlltfvcqkvaldfesnapdsammhqqkqvpcitsmlt
    rllvfgkk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1m72C (C:)
    algsnsssqpnrvarmpvdrnapyynmnhkhrgmaiifnhehfdihslksrtgtnvdsdn
    lskvlktlgfkvtvfpnlkseeinkfiqqtaemdhsdadcllvavlthgelgmlyakdth
    ykpdnlwyyftadkcptlagkpklffiqacqgdrldggitlsrtetdgspstsyripvha
    dfliafstvpgyfswrnttrgswfmqalceelryagterdiltlltfvcqkvaldfesna
    pdsammhqqkqvpcitsmltrllvfgkkqshl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m72C (C:)
    rvarmpvdrnapyynmnhkhrgmaiifnhehfdihslksrtgtnvdsdnlskvlktlgfk
    vtvfpnlkseeinkfiqqtaemdhsdadcllvavlthgelgmlyakdthykpdnlwyyft
    adkcptlagkpklffiqacqgdrldggitlsrsyripvhadfliafstvpgyfswrnttr
    gswfmqalceelryagterdiltlltfvcqkvaldfesnapdsammhqqkqvpcitsmlt
    rllvfgkkqshl
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.