PDB entry 1m71

View 1m71 on RCSB PDB site
Description: Crystal structure of a Monoclonal Fab Specific for Shigella Flexneri Y lipopolysaccharide
Class: immune system
Keywords: Fab-carbohydrate interactions, anti-carbohydrate antibody, X-ray Diffracrion, Shigella O-antigen, IMMUNE SYSTEM
Deposited on 2002-07-18, released 2003-07-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.223
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: light chain of the monoclonal antibody Fab SYA/J6
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1M71 (0-214)
    Domains in SCOPe 2.05: d1m71a1, d1m71a2
  • Chain 'B':
    Compound: heavy chain of the monoclonal antibody Fab SYA/J6
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1M71 (0-219)
    Domains in SCOPe 2.05: d1m71b1, d1m71b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m71A (A:)
    dvvltqtplslpvrlgdqasiscrssqsllhsdgntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqtthvptfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m71B (B:)
    evkveesggglvqpggsmklscvasgftfsnywmewvrqspekglewvaeirlksnnyat
    hyaesvkgrftisrddskssvylqmnnlraedtgiyyctrggavgamdywgqgtsvtvss
    atttapsvyplvpgcsdtsgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsg
    fyslsslvtvpsstwpsqtvicnvahpaskvdlikepsgp