PDB entry 1m6z

View 1m6z on RCSB PDB site
Description: Crystal structure of reduced recombinant cytochrome c4 from Pseudomonas stutzeri
Class: Electron Transport
Keywords: Electron Transport, diheme protein
Deposited on 2002-07-18, released 2003-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.143
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c4
    Species: Pseudomonas stutzeri [TaxId:316]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m6za1, d1m6za2
  • Chain 'B':
    Compound: cytochrome c4
    Species: Pseudomonas stutzeri [TaxId:316]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m6zb1, d1m6zb2
  • Chain 'C':
    Compound: cytochrome c4
    Species: Pseudomonas stutzeri [TaxId:316]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m6zc1, d1m6zc2
  • Chain 'D':
    Compound: cytochrome c4
    Species: Pseudomonas stutzeri [TaxId:316]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m6zd1, d1m6zd2
  • Heterogens: HEC, TRS, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m6zA (A:)
    agdaeagqgkvavcgachgvdgnspapnfpklagqgeryllkqlqdikagstpgapegvg
    rkvlemtgmldplsdqdlediaayfssqkgsvgyadpalakqgeklfrggkldqgmpact
    gchapngvgndlagfpklggqhaaytakqltdfregnrtndgdtmimrgvaaklsnkdie
    alssyiqglh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m6zB (B:)
    agdaeagqgkvavcgachgvdgnspapnfpklagqgeryllkqlqdikagstpgapegvg
    rkvlemtgmldplsdqdlediaayfssqkgsvgyadpalakqgeklfrggkldqgmpact
    gchapngvgndlagfpklggqhaaytakqltdfregnrtndgdtmimrgvaaklsnkdie
    alssyiqglh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m6zC (C:)
    agdaeagqgkvavcgachgvdgnspapnfpklagqgeryllkqlqdikagstpgapegvg
    rkvlemtgmldplsdqdlediaayfssqkgsvgyadpalakqgeklfrggkldqgmpact
    gchapngvgndlagfpklggqhaaytakqltdfregnrtndgdtmimrgvaaklsnkdie
    alssyiqglh
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m6zD (D:)
    agdaeagqgkvavcgachgvdgnspapnfpklagqgeryllkqlqdikagstpgapegvg
    rkvlemtgmldplsdqdlediaayfssqkgsvgyadpalakqgeklfrggkldqgmpact
    gchapngvgndlagfpklggqhaaytakqltdfregnrtndgdtmimrgvaaklsnkdie
    alssyiqglh