PDB entry 1m6y

View 1m6y on RCSB PDB site
Description: Crystal Structure Analysis of TM0872, a Putative SAM-dependent Methyltransferase, Complexed with SAH
Class: transferase
Keywords: SAM-dependent Methyltransferase Fold, Protein-Cofactor Product Complex, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2002-07-17, released 2003-01-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.197
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S-adenosyl-methyltransferase mraW
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0872
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZX6
      • modified residue (13)
      • modified residue (103)
      • modified residue (129)
      • modified residue (131)
    Domains in SCOPe 2.06: d1m6ya1, d1m6ya2
  • Chain 'B':
    Compound: S-adenosyl-methyltransferase mraW
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0872
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZX6
      • modified residue (13)
      • modified residue (103)
      • modified residue (129)
      • modified residue (131)
    Domains in SCOPe 2.06: d1m6yb1, d1m6yb2
  • Heterogens: SO4, SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m6yA (A:)
    ghmrkysqrhipvmvrevieflkpedekiildctvgegghsrailehcpgcriigidvds
    evlriaeeklkefsdrvslfkvsyreadfllktlgiekvdgilmdlgvstyqlkgenrgf
    tfereepldmrmdlesevtaqkvlnelpeeelariifeygeekrfarriarkivenrpln
    ttldlvkavrealpsyeirrrkrhfatktfqairiyvnrelenlkeflkkaedllnpggr
    ivvisfhsledrivketfrnskklriltekpvrpseeeirenprarsgrlraaerieegg
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m6yA (A:)
    rkysqrhipvmvrevieflkpedekiildctvgegghsrailehcpgcriigidvdsevl
    riaeeklkefsdrvslfkvsyreadfllktlgiekvdgilmdlgvstyqlkgenrgftfe
    reepldmrmdlesevtaqkvlnelpeeelariifeygeekrfarriarkivenrplnttl
    dlvkavrealpsyeirrrkrhfatktfqairiyvnrelenlkeflkkaedllnpggrivv
    isfhsledrivketfrnskklriltekpvrpseeeirenprarsgrlraaeri
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m6yB (B:)
    ghmrkysqrhipvmvrevieflkpedekiildctvgegghsrailehcpgcriigidvds
    evlriaeeklkefsdrvslfkvsyreadfllktlgiekvdgilmdlgvstyqlkgenrgf
    tfereepldmrmdlesevtaqkvlnelpeeelariifeygeekrfarriarkivenrpln
    ttldlvkavrealpsyeirrrkrhfatktfqairiyvnrelenlkeflkkaedllnpggr
    ivvisfhsledrivketfrnskklriltekpvrpseeeirenprarsgrlraaerieegg
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m6yB (B:)
    hipvmvrevieflkpedekiildctvgegghsrailehcpgcriigidvdsevlriaeek
    lkefsdrvslfkvsyreadfllktlgiekvdgilmdlgvstyqlkgenrgftfereepld
    mrmdlesevtaqkvlnelpeeelariifeygeekrfarriarkivenrplnttldlvkav
    realpsyeirrrkrhfatktfqairiyvnrelenlkeflkkaedllnpggrivvisfhsl
    edrivketfrnskklriltekpvrpsprarsgrlraae