PDB entry 1m6w

View 1m6w on RCSB PDB site
Description: Binary complex of Human glutathione-dependent formaldehyde dehydrogenase and 12-Hydroxydodecanoic acid
Class: oxidoreductase
Keywords: Glutathione-dependent formaldehyde dehydrogenase, Class III alcohol dehydrogenase, OXIDOREDUCTASE
Deposited on 2002-07-17, released 2002-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.191
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione-dependent formaldehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ADH5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m6wa1, d1m6wa2
  • Chain 'B':
    Compound: Glutathione-dependent formaldehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ADH5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m6wb1, d1m6wb2
  • Heterogens: ZN, K, PO4, 12H, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m6wA (A:)
    anevikckaavaweagkplsieeievappkahevrikiiatavchtdaytlsgadpegcf
    pvilghegagivesvgegvtklkagdtviplyipqcgeckfclnpktnlcqkirvtqgkg
    lmpdgtsrftckgktilhymgtstfseytvvadisvakidplapldkvcllgcgistgyg
    aavntaklepgsvcavfglggvglavimgckvagasriigvdinkdkfarakefgateci
    npqdfskpiqevliemtdggvdysfecignvkvmraaleachkgwgvsvvvgvaasgeei
    atrpfqlvtgrtwkgtafggwksvesvpklvseymskkikvdefvthnlsfdeinkafel
    mhsgksirtvvki
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m6wB (B:)
    anevikckaavaweagkplsieeievappkahevrikiiatavchtdaytlsgadpegcf
    pvilghegagivesvgegvtklkagdtviplyipqcgeckfclnpktnlcqkirvtqgkg
    lmpdgtsrftckgktilhymgtstfseytvvadisvakidplapldkvcllgcgistgyg
    aavntaklepgsvcavfglggvglavimgckvagasriigvdinkdkfarakefgateci
    npqdfskpiqevliemtdggvdysfecignvkvmraaleachkgwgvsvvvgvaasgeei
    atrpfqlvtgrtwkgtafggwksvesvpklvseymskkikvdefvthnlsfdeinkafel
    mhsgksirtvvki