PDB entry 1m6t

View 1m6t on RCSB PDB site
Description: crystal structure of b562ril, a redesigned four helix bundle
Class: electron transport
Keywords: protein design, ELECTRON TRANSPORT
Deposited on 2002-07-17, released 2002-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.21
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cytB562
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (6)
      • engineered (101)
      • engineered (105)
    Domains in SCOPe 2.07: d1m6ta_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m6tA (A:)
    adlednwetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemkd
    frhgfdilvgqiddalklanegkvkeaqaaaeqlkttrnayiqkyl