PDB entry 1m6s

View 1m6s on RCSB PDB site
Description: crystal structure of threonine aldolase
Deposited on 2002-07-17, released 2002-12-11
The last revision prior to the SCOP 1.71 freeze date was dated 2002-12-11, with a file datestamp of 2002-12-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.199
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1m6sa_
  • Chain 'B':
    Domains in SCOP 1.71: d1m6sb_
  • Chain 'C':
    Domains in SCOP 1.71: d1m6sc_
  • Chain 'D':
    Domains in SCOP 1.71: d1m6sd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m6sA (A:)
    gphmmidlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvp
    sgtmgnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvr
    kairprnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnas
    iasgvpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvl
    aaagiialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgf
    iealrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m6sA (A:)
    midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtm
    gnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkair
    prnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasg
    vpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaag
    iialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfieal
    rnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m6sB (B:)
    gphmmidlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvp
    sgtmgnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvr
    kairprnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnas
    iasgvpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvl
    aaagiialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgf
    iealrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m6sB (B:)
    midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtm
    gnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkair
    prnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasg
    vpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaag
    iialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfieal
    rnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1m6sC (C:)
    gphmmidlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvp
    sgtmgnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvr
    kairprnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnas
    iasgvpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvl
    aaagiialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgf
    iealrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m6sC (C:)
    midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtm
    gnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkair
    prnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasg
    vpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaag
    iialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfieal
    rnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1m6sD (D:)
    gphmmidlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvp
    sgtmgnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvr
    kairprnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnas
    iasgvpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvl
    aaagiialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgf
    iealrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m6sD (D:)
    mmidlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgt
    mgnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkai
    rprnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasias
    gvpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaa
    giialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfiea
    lrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs