PDB entry 1m6n

View 1m6n on RCSB PDB site
Description: Crystal structure of the SecA translocation ATPase from Bacillus subtilis
Class: protein transport
Keywords: protein translocation; atpase; transmembrane transport; helicase family structure; mechanochemisty, PROTEIN TRANSPORT
Deposited on 2002-07-16, released 2002-09-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.22
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Preprotein translocase secA
    Species: Bacillus subtilis [TaxId:1423]
    Gene: Div
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1m6na1, d1m6na2, d1m6na3, d1m6na4
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m6nA (A:)
    mlgilnkmfdptkrtlnryekiandidairgdyenlsddalkhktiefkerlekgattdd
    llveafavvreasrrvtgmfpfkvqlmggvalhdgniaemktgegktltstlpvylnalt
    gkgvhvvtvneylasrdaeqmgkifeflgltvglnlnsmskdekreayaaditystnnel
    gfdylrdnmvlykeqmvqrplhfavidevdsilideartpliisgqaakstklyvqanaf
    vrtlkaekdytydiktkavqlteegmtkaekafgidnlfdvkhvalnhhinqalkahvam
    qkdvdyvvedgqvvivdsftgrlmkgrryseglhqaieakegleiqnesmtlatitfqny
    frmyeklagmtgtakteeeefrniynmqvvtiptnrpvvrddrpdliyrtmegkfkavae
    dvaqrymtgqpvlvgtvavetseliskllknkgiphqvlnaknhereaqiieeagqkgav
    tiatnmagrgtdiklgegvkelgglavvgterhesrridnqlrgrsgrqgdpgitqfyls
    medelmrrfgaertmamldrfgmddstpiqskmvsravessqkrvegnnfdsrkqllqyd
    dvlrqqreviykqrfevidsenlreivenmikssleraiaaytpreelpeewkldglvdl
    inttyldegaleksdifgkepdemlelimdriitkynekeeqfgkeqmrefekvivlrav
    dskwmdhidamdqlrqgihlrayaqtnplreyqmegfamfehmiesiedevakfvmkaei
    ennlereevvqgqttahqpqeg