PDB entry 1m6m

View 1m6m on RCSB PDB site
Description: v68n met myoglobin
Class: oxygen storage/transport
Keywords: oxygen storage, myoglobin, met
Deposited on 1998-08-13, released 1998-08-19
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.212
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (myoglobin)
    Species: SUS SCROFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02189 (0-152)
      • engineered (67)
    Domains in SCOP 1.75: d1m6ma_
  • Chain 'B':
    Compound: protein (myoglobin)
    Species: SUS SCROFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02189 (0-152)
      • engineered (67)
    Domains in SCOP 1.75: d1m6mb_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1m6mA (A:)
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
lkkhgntnltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgfqg

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1m6mB (B:)
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
lkkhgntnltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgfqg