PDB entry 1m6j

View 1m6j on RCSB PDB site
Description: crystal structure of triosephosphate isomerase from entamoeba histolytica
Class: isomerase
Keywords: Asymmetry, Entamoeba histolytica, monomer stability, triosephosphate isomerase
Deposited on 2002-07-16, released 2002-10-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.184
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Entamoeba histolytica [TaxId:5759]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot O02611 (Start-260)
      • conflict (260)
    Domains in SCOPe 2.01: d1m6ja_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Entamoeba histolytica [TaxId:5759]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot O02611 (Start-260)
      • conflict (260)
    Domains in SCOPe 2.01: d1m6jb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m6jA (A:)
    mgagkfvvggnwkcngtlasietltkgvaasvdaelakkvevivgvpfiyipkvqqilag
    eanganilvsaenawtksgaytgevhvgmlvdcqvpyvilghserrqifhesneqvaekv
    kvaidaglkviacigeteaqrianqteevvaaqlkainnaiskeawkniilayepvwaig
    tgktatpdqaqevhqyirkwmteniskevaeatriqyggsvnpancnelakkadidgflv
    ggasldaakfktiinsvsekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m6jA (A:)
    gagkfvvggnwkcngtlasietltkgvaasvdaelakkvevivgvpfiyipkvqqilage
    anganilvsaenawtksgaytgevhvgmlvdcqvpyvilghserrqifhesneqvaekvk
    vaidaglkviacigeteaqrianqteevvaaqlkainnaiskeawkniilayepvwaigt
    gktatpdqaqevhqyirkwmteniskevaeatriqyggsvnpancnelakkadidgflvg
    gasldaakfktiinsvsekl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m6jB (B:)
    mgagkfvvggnwkcngtlasietltkgvaasvdaelakkvevivgvpfiyipkvqqilag
    eanganilvsaenawtksgaytgevhvgmlvdcqvpyvilghserrqifhesneqvaekv
    kvaidaglkviacigeteaqrianqteevvaaqlkainnaiskeawkniilayepvwaig
    tgktatpdqaqevhqyirkwmteniskevaeatriqyggsvnpancnelakkadidgflv
    ggasldaakfktiinsvsekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m6jB (B:)
    gagkfvvggnwkcngtlasietltkgvaasvdaelakkvevivgvpfiyipkvqqilage
    anganilvsaenawtksgaytgevhvgmlvdcqvpyvilghserrqifhesneqvaekvk
    vaidaglkviacigeteaqrianqteevvaaqlkainnaiskeawkniilayepvwaigt
    gktatpdqaqevhqyirkwmteniskevaeatriqyggsvnpancnelakkadidgflvg
    gasldaakfktiinsvsekl