PDB entry 1m6i

View 1m6i on RCSB PDB site
Description: Crystal Structure of Apoptosis Inducing Factor (AIF)
Deposited on 2002-07-16, released 2002-08-28
The last revision prior to the SCOP 1.61 freeze date was dated 2002-08-28, with a file datestamp of 2002-08-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.225
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m6iA (A:)
    apshvpflligggtaafaaarsirardpgarvlivsedpelpymrpplskelwfsddpnv
    tktlrfkqwngkersiyfqppsfyvsaqdlphienggvavltgkkvvqldvrdnmvklnd
    gsqityekcliatggtprslsaidragaevksrttlfrkigdfrslekisrevksitiig
    ggflgselacalgrkaralgteviqlfpekgnmgkilpeylsnwtmekvrregvkvmpna
    ivqsvgvssgklliklkdgrkvetdhivaavglepnvelaktggleidsdfggfrvnael
    qarsniwvagdaacfydiklgrrrvehhdhavvsgrlagenmtgaakpywhqsmfwsdlg
    pdvgyeaiglvdsslptvgvfakataqdnpksateqsgtgirseseteseaseitippst
    pavpqapvqgedygkgvifylrdkvvvgivlwnifnrmpiarkiikdgeqhedlnevakl
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m6iA (A:)
    apshvpflligggtaafaaarsirardpgarvlivsedpelpymrpplskelwfspnvtk
    tlrfkqwngkersiyfqppsfyvsaqdlphienggvavltgkkvvqldvrdnmvklndgs
    qityekcliatggtprslsaidragaevksrttlfrkigdfrslekisrevksitiiggg
    flgselacalgrkaralgteviqlfpekgnmgkilpeylsnwtmekvrregvkvmpnaiv
    qsvgvssgklliklkdgrkvetdhivaavglepnvelaktggleidsdfggfrvnaelqa
    rsniwvagdaacfydiklgrrrvehhdhavvsgrlagenmtgaakpywhqsmfwsdlgpd
    vgyeaiglvdsslptvgvfakataqdnpksateqsgtgirseseteseasygkgvifylr
    dkvvvgivlwnifnrmpiarkiikdgeqhedlnevaklf