PDB entry 1m6i

View 1m6i on RCSB PDB site
Description: Crystal Structure of Apoptosis Inducing Factor (AIF)
Class: oxidoreductase
Keywords: Apoptosis, AIF, OXIDOREDUCTASE
Deposited on 2002-07-16, released 2002-08-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.225
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Programmed cell death protein 8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1m6ia1, d1m6ia2, d1m6ia3
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m6iA (A:)
    eevpqdkapshvpflligggtaafaaarsirardpgarvlivsedpelpymrpplskelw
    fsddpnvtktlrfkqwngkersiyfqppsfyvsaqdlphienggvavltgkkvvqldvrd
    nmvklndgsqityekcliatggtprslsaidragaevksrttlfrkigdfrslekisrev
    ksitiigggflgselacalgrkaralgteviqlfpekgnmgkilpeylsnwtmekvrreg
    vkvmpnaivqsvgvssgklliklkdgrkvetdhivaavglepnvelaktggleidsdfgg
    frvnaelqarsniwvagdaacfydiklgrrrvehhdhavvsgrlagenmtgaakpywhqs
    mfwsdlgpdvgyeaiglvdsslptvgvfakataqdnpksateqsgtgirsesetesease
    itippstpavpqapvqgedygkgvifylrdkvvvgivlwnifnrmpiarkiikdgeqhed
    lnevaklfnihed
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m6iA (A:)
    apshvpflligggtaafaaarsirardpgarvlivsedpelpymrpplskelwfspnvtk
    tlrfkqwngkersiyfqppsfyvsaqdlphienggvavltgkkvvqldvrdnmvklndgs
    qityekcliatggtprslsaidragaevksrttlfrkigdfrslekisrevksitiiggg
    flgselacalgrkaralgteviqlfpekgnmgkilpeylsnwtmekvrregvkvmpnaiv
    qsvgvssgklliklkdgrkvetdhivaavglepnvelaktggleidsdfggfrvnaelqa
    rsniwvagdaacfydiklgrrrvehhdhavvsgrlagenmtgaakpywhqsmfwsdlgpd
    vgyeaiglvdsslptvgvfakataqdnpksateqsgtgirseseteseasygkgvifylr
    dkvvvgivlwnifnrmpiarkiikdgeqhedlnevaklf