PDB entry 1m6h

View 1m6h on RCSB PDB site
Description: Human glutathione-dependent formaldehyde dehydrogenase
Deposited on 2002-07-16, released 2002-07-26
The last revision prior to the SCOP 1.63 freeze date was dated 2002-07-26, with a file datestamp of 2002-07-26.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.185
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m6hA (A:)
    anevikckaavaweagkplsieeievappkahevrikiiatavchtdaytlsgadpegcf
    pvilghegagivesvgegvtklkagdtviplyipqcgeckfclnpktnlcqkirvtqgkg
    lmpdgtsrftckgktilhymgtstfseytvvadisvakidplapldkvcllgcgistgyg
    aavntaklepgsvcavfglggvglavimgckvagasriigvdinkdkfarakefgateci
    npqdfskpiqevliemtdggvdysfecignvkvmraaleachkgwgvsvvvgvaasgeei
    atrpfqlvtgrtwkgtafggwksvesvpklvseymskkikvdefvthnlsfdeinkafel
    mhsgksirtvvki
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m6hB (B:)
    anevikckaavaweagkplsieeievappkahevrikiiatavchtdaytlsgadpegcf
    pvilghegagivesvgegvtklkagdtviplyipqcgeckfclnpktnlcqkirvtqgkg
    lmpdgtsrftckgktilhymgtstfseytvvadisvakidplapldkvcllgcgistgyg
    aavntaklepgsvcavfglggvglavimgckvagasriigvdinkdkfarakefgateci
    npqdfskpiqevliemtdggvdysfecignvkvmraaleachkgwgvsvvvgvaasgeei
    atrpfqlvtgrtwkgtafggwksvesvpklvseymskkikvdefvthnlsfdeinkafel
    mhsgksirtvvki