PDB entry 1m6e

View 1m6e on RCSB PDB site
Description: crystal structure of salicylic acid carboxyl methyltransferase (samt)
Deposited on 2002-07-16, released 2003-09-09
The last revision prior to the SCOP 1.69 freeze date was dated 2003-09-09, with a file datestamp of 2003-09-09.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.225
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Domains in SCOP 1.69: d1m6ex_

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m6eX (X:)
    mdvrqvlhmkggagensyamnsfiqrqvisitkpiteaaitalysgdtvttrlaiadlgc
    ssgpnalfavteliktveelrkkmgrenspeyqiflndlpgndfnaifrslpiendvdgv
    cfingvpgsfygrlfprntlhfihssyslmwlsqvpigiesnkgniymantcpqsvlnay
    ykqfqedhalflrcraqevvpggrmvltilgrrsedrasteccliwqllamalnqmvseg
    lieeekmdkfnipqytpspteveaeilkegsflidhieaseiywssctkdgdgggsveee
    gynvarcmravaepllldhfgeaiiedvfhryklliiermskektkfinvivslirksd