PDB entry 1m6e

View 1m6e on RCSB PDB site
Description: crystal structure of salicylic acid carboxyl methyltransferase (samt)
Class: transferase
Keywords: Rossmann fold, protein-small molecule complex, TRANSFERASE
Deposited on 2002-07-16, released 2003-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.225
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase
    Species: Clarkia breweri [TaxId:36903]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m6ex_
  • Heterogens: LU, SAH, SAL, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m6eX (X:)
    mdvrqvlhmkggagensyamnsfiqrqvisitkpiteaaitalysgdtvttrlaiadlgc
    ssgpnalfavteliktveelrkkmgrenspeyqiflndlpgndfnaifrslpiendvdgv
    cfingvpgsfygrlfprntlhfihssyslmwlsqvpigiesnkgniymantcpqsvlnay
    ykqfqedhalflrcraqevvpggrmvltilgrrsedrasteccliwqllamalnqmvseg
    lieeekmdkfnipqytpspteveaeilkegsflidhieaseiywssctkdgdgggsveee
    gynvarcmravaepllldhfgeaiiedvfhryklliiermskektkfinvivslirksd