PDB entry 1m6b

View 1m6b on RCSB PDB site
Description: Structure of the HER3 (ERBB3) Extracellular Domain
Class: signaling protein, transferase
Keywords: tyrosine kinase; cell surface receptor; immunity, SIGNALING PROTEIN, TRANSFERASE
Deposited on 2002-07-15, released 2002-08-02
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.238
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Receptor protein-tyrosine kinase erbB-3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21860
      • engineered (60)
    Domains in SCOPe 2.02: d1m6ba1, d1m6ba2, d1m6ba3, d1m6ba4
  • Chain 'B':
    Compound: Receptor protein-tyrosine kinase erbB-3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21860
      • engineered (60)
    Domains in SCOPe 2.02: d1m6bb1, d1m6bb2, d1m6bb3, d1m6bb4
  • Heterogens: NAG, NDG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m6bA (A:)
    sevgnsqavcpgtlnglsvtgdaenqyqtlyklyercevvmgnleivltghnadlsflqw
    vrevtgyvlvamnefstlplpnlrvvrgtqvydgkfaifvmlnyntnsshalrqlrltql
    teilsggvyiekndklchmdtidwrdivrdrdaeivvkdngrscppchevckgrcwgpgs
    edcqtltkticapqcnghcfgpnpnqcchdecaggcsgpqdtdcfacrhfndsgacvprc
    pqplvynkltfqlepnphtkyqyggvcvascphnfvvdqtscvracppdkmevdknglkm
    cepcgglcpkacegtgsgsrfqtvdssnidgfvnctkilgnldflitglngdpwhkipal
    dpeklnvfrtvreitgylniqswpphmhnfsvfsnlttiggrslynrgfsllimknlnvt
    slgfrslkeisagriyisanrqlcyhhslnwtkvlrgpteerldikhnrprrdcvaegkv
    cdplcssggcwgpgpgqclscrnysrggvcvthcnflngeprefaheaecfschpecqpm
    egtatcngsgsdtcaqcahfrdgphcvsscphgvlgakgpiykypdvqnecrpchenctq
    gckgpelqdclgqtlvligkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m6bA (A:)
    avcprcevvmgnleivltghnadlsflqwvrevtgyvlvamnefstlplpnlrvvrgtqv
    ydgkfaifvmlnyntnsshalrqlrltqlteilsggvyiekndklchmdtidwrdivrdr
    daeivvkdngrscppchevckgrcwgpgsedcqtltkticapqcnghcfgpnpnqcchde
    caggcsgpqdtdcfacrhfndsgacvprcpqplvynkltfqlepnphtkyqyggvcvasc
    phnfvvdqtscvracppdkmevdknglkmcepcgglcpkacegtgsgsrfqtvdssnidg
    fvnctkilgnldflitglngdpwhkipaldpeklnvfrtvreitgylniqswpphmhnfs
    vfsnlttiggrslynrgfsllimknlnvtslgfrslkeisagriyisanrqlcyhhslnw
    tkvlrgpteerldikhnrprrdcvaegkvcdplcssggcwgpgpgqclscrnysrggvcv
    thcnflngeprefaheaecfschpecqpmegtatcngsgsdtcaqcahfrdgphcvsscp
    hgvlgakgp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m6bB (B:)
    sevgnsqavcpgtlnglsvtgdaenqyqtlyklyercevvmgnleivltghnadlsflqw
    vrevtgyvlvamnefstlplpnlrvvrgtqvydgkfaifvmlnyntnsshalrqlrltql
    teilsggvyiekndklchmdtidwrdivrdrdaeivvkdngrscppchevckgrcwgpgs
    edcqtltkticapqcnghcfgpnpnqcchdecaggcsgpqdtdcfacrhfndsgacvprc
    pqplvynkltfqlepnphtkyqyggvcvascphnfvvdqtscvracppdkmevdknglkm
    cepcgglcpkacegtgsgsrfqtvdssnidgfvnctkilgnldflitglngdpwhkipal
    dpeklnvfrtvreitgylniqswpphmhnfsvfsnlttiggrslynrgfsllimknlnvt
    slgfrslkeisagriyisanrqlcyhhslnwtkvlrgpteerldikhnrprrdcvaegkv
    cdplcssggcwgpgpgqclscrnysrggvcvthcnflngeprefaheaecfschpecqpm
    egtatcngsgsdtcaqcahfrdgphcvsscphgvlgakgpiykypdvqnecrpchenctq
    gckgpelqdclgqtlvligkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m6bB (B:)
    sqavcpgtrcevvmgnleivltghnadlsflqwvrevtgyvlvamnefstlplpnlrvvr
    gtqvydgkfaifvmlnyntnsshalrqlrltqlteilsggvyiekndklchmdtidwrdi
    vrdrdaeivvkdngrscppchevckgrcwgpgsedcqtltkticapqcnghcfgpnpnqc
    chdecaggcsgpqdtdcfacrhfndsgacvprcpqplvynkltfqlepnphtkyqyggvc
    vascphnfvvdqtscvracppdkmevdknglkmcepcgglcpkacegtgsgsrfqtvdss
    nidgfvnctkilgnldflitglngdpwhkipaldpeklnvfrtvreitgylniqswpphm
    hnfsvfsnlttiggrslynrgfsllimknlnvtslgfrslkeisagriyisanrqlcyhh
    slnwtkvlrgpteerldikhnrprrdcvaegkvcdplcssggcwgpgpgqclscrnysrg
    gvcvthcnflngeprefaheaecfschpecqpmegtatcngsgsdtcaqcahfrdgphcv
    sscphgvlgakgpiykypdvqnecrpchenctqgckgpelqdcl