PDB entry 1m68

View 1m68 on RCSB PDB site
Description: ycdx protein, trinuclear zinc site
Deposited on 2002-07-14, released 2003-04-22
The last revision prior to the SCOP 1.65 freeze date was dated 2003-04-22, with a file datestamp of 2003-04-22.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.165
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1m68a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m68A (A:)
    mypvdlhmhtvasthaystlsdyiaqakqkgiklfaitdhgpdmedaphhwhfinmriwp
    rvvdgvgilrgieaniknvdgeidcsgkmfdsldliiagfhepvfaphdkatntqamiat
    iasgnvhiishpgnpkyeidvkavaeaaakhqvaleinnssflhsrkgsedncrevaaav
    rdaggwvalgsdshtaftmgefeeclkildavdfpperilnvsprrllnflesrgmapia
    efadl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m68A (A:)
    ypvdlhmhtvasthaystlsdyiaqakqkgiklfaitdhgpdmedaphhwhfinmriwpr
    vvdgvgilrgieaniknvdgeidcsgkmfdsldliiagfhepvfaphdkatntqamiati
    asgnvhiishpgnpkyeidvkavaeaaakhqvaleinnssncrevaaavrdaggwvalgs
    dshtaftmgefeeclkildavdfpperilnvsprrllnflesrgmapiaefadl