PDB entry 1m63

View 1m63 on RCSB PDB site
Description: Crystal structure of calcineurin-cyclophilin-cyclosporin shows common but distinct recognition of immunophilin-drug complexes
Class: hydrolase/isomerase/immunosuppressant
Keywords: hydrolase-isomerase-immunosuppressant complex, immunophilin, calcineurin, cyclosporin a, immunosuppressant, cyclophilin
Deposited on 2002-07-12, released 2002-09-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.26
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine protein phosphatase 2b catalytic subunit, alpha isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: CNA ALPHA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1m63a_
  • Chain 'B':
    Compound: calcineurin b subunit isoform 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CNB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1m63b_
  • Chain 'C':
    Compound: Peptidyl-prolyl cis-trans isomerase A
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1m63c_
  • Chain 'D':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
  • Chain 'E':
    Compound: serine/threonine protein phosphatase 2b catalytic subunit, alpha isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: CNA ALPHA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1m63e_
  • Chain 'F':
    Compound: calcineurin b subunit isoform 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CNB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1m63f_
  • Chain 'G':
    Compound: Peptidyl-prolyl cis-trans isomerase A
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1m63g_
  • Chain 'H':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
  • Heterogens: CA, ZN, FE

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m63A (A:)
    msepkaidpklsttdrvvkavpfppshrltakevfdndgkprvdilkahlmkegrleesv
    alriitegasilrqeknlldidapvtvcgdihgqffdlmklfevggspantrylflgdyv
    drgyfsiecvlylwalkilypktlfllrgnhecrhlteyftfkqeckikyservydacmd
    afdclplaalmnqqflcvhgglspeintlddirkldrfkeppaygpmcdilwsdpledfg
    nektqehfthntvrgcsyfysypavceflqhnnllsilraheaqdagyrmyrksqttgfp
    slitifsapnyldvynnkaavlkyennvmnirqfncsphpywlpnfmdvftwslpfvgek
    vtemlvnvlnic
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m63B (B:)
    gneasyplemcshfdadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvidi
    fdtdgngevdfkefiegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmvg
    nnlkdtqlqqivdktiinadkdgdgrisfeefcavvggldihkkmvvdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m63B (B:)
    shfdadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvidifdtdgngevdf
    kefiegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmvgnnlkdtqlqqi
    vdktiinadkdgdgrisfeefcavvggldihkkmvvdv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m63C (C:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1m63E (E:)
    msepkaidpklsttdrvvkavpfppshrltakevfdndgkprvdilkahlmkegrleesv
    alriitegasilrqeknlldidapvtvcgdihgqffdlmklfevggspantrylflgdyv
    drgyfsiecvlylwalkilypktlfllrgnhecrhlteyftfkqeckikyservydacmd
    afdclplaalmnqqflcvhgglspeintlddirkldrfkeppaygpmcdilwsdpledfg
    nektqehfthntvrgcsyfysypavceflqhnnllsilraheaqdagyrmyrksqttgfp
    slitifsapnyldvynnkaavlkyennvmnirqfncsphpywlpnfmdvftwslpfvgek
    vtemlvnvlnic
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m63E (E:)
    tdrvvkavpfppshrltakevfdndgkprvdilkahlmkegrleesvalriitegasilr
    qeknlldidapvtvcgdihgqffdlmklfevggspantrylflgdyvdrgyfsiecvlyl
    walkilypktlfllrgnhecrhlteyftfkqeckikyservydacmdafdclplaalmnq
    qflcvhgglspeintlddirkldrfkeppaygpmcdilwsdpledfgnektqehfthntv
    rgcsyfysypavceflqhnnllsilraheaqdagyrmyrksqttgfpslitifsapnyld
    vynnkaavlkyennvmnirqfncsphpywlpnfmdvftwslpfvgekvtemlvnvlnic
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1m63F (F:)
    gneasyplemcshfdadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvidi
    fdtdgngevdfkefiegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmvg
    nnlkdtqlqqivdktiinadkdgdgrisfeefcavvggldihkkmvvdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m63F (F:)
    mcshfdadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvidifdtdgngev
    dfkefiegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmvgnnlkdtqlq
    qivdktiinadkdgdgrisfeefcavvggldihkkmvvdv
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m63G (G:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'H':
    No sequence available.