PDB entry 1m61

View 1m61 on RCSB PDB site
Description: Crystal structure of the apo SH2 domains of ZAP-70
Class: transferase
Keywords: apo form, TRANSFERASE
Deposited on 2002-07-11, released 2003-07-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.245
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine-protein kinase zap-70
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43403 (3-258)
      • cloning artifact (0-2)
    Domains in SCOPe 2.06: d1m61a1, d1m61a2, d1m61a3
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m61A (A:)
    gshmpdpaahlpffygsisraeaeehlklagmadglfllrqclrslggyvlslvhdvrfh
    hfpierqlngtyaiaggkahcgpaelcefysrdpdglpcnlrkpcnrpsglepqpgvfdc
    lrdamvrdyvrqtwklegealeqaiisqapqvekliattahermpwyhssltreeaerkl
    ysgaqtdgkfllrprkeqgtyalsliygktvyhylisqdkagkycipegtkfdtlwqlve
    ylklkadgliyclkeacpn